Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INO80C Rabbit Polyclonal Antibody (FITC)

INO80C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IES6, hIes6, C18orf37

UniProt

Q6PI98

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kdm4d 3'UTR Lenti-reporter-Luc Vector
25477086 1.0 µg

Kdm4d 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Fas Ligand Mouse mAb
orb2716931-01 50 µL

Fas Ligand Mouse mAb

Sign In for Pricing
View Details
Fas Ligand Mouse mAb
orb2716931-02 100 µL

Fas Ligand Mouse mAb

Sign In for Pricing
View Details
MBTD1 Protein Vector (Human) (pPM-C-His)
PV093497 500 ng

MBTD1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ZNF157 Antibody - N-terminal region : HRP (ARP57911_P050-HRP)
ARP57911_P050-HRP 100 µL

ZNF157 Antibody - N-terminal region : HRP (ARP57911_P050-HRP)

Sign In for Pricing
View Details
Goat Anti Hamster Igg Polyclonal Antibody,FITC
DPBT-68230GH 0.7 mg

Goat Anti Hamster Igg Polyclonal Antibody,FITC

Sign In for Pricing
View Details