Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INO80C Rabbit Polyclonal Antibody (HRP)

INO80C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IES6, hIes6, C18orf37

UniProt

Q6PI98

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: rectosigmoid
CS709916 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
VPS50 Human Gene Knockout Kit (CRISPR)
KN418218 1 Kit

VPS50 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant RSV (A, rsb1734) glycoprotein G / RSV-G Protein (93% Homology) (His Tag)
PKSV030229 100 µg

Recombinant RSV (A, rsb1734) glycoprotein G / RSV-G Protein (93% Homology) (His Tag)

Sign In for Pricing
View Details
TGFA Polyclonal Antibody
E-AB-65923-01 60 µL

TGFA Polyclonal Antibody

Sign In for Pricing
View Details
TGFA Polyclonal Antibody
E-AB-65923-02 120 µL

TGFA Polyclonal Antibody

Sign In for Pricing
View Details
TGFA Polyclonal Antibody
E-AB-65923-03 200 µL

TGFA Polyclonal Antibody

Sign In for Pricing
View Details