Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS2 Rabbit Polyclonal Antibody (FITC)

INTS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INT2, KIAA1287

UniProt

Q9H0H0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human INTS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065799

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2C Rabbit Polyclonal Antibody (Carrier-free)
orb3108204 100 µg

CDKN2C Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
AR Polyclonal Antibody
orb310150-01 50 μL

AR Polyclonal Antibody

Sign In for Pricing
View Details
AR Polyclonal Antibody
orb310150-02 100 µL

AR Polyclonal Antibody

Sign In for Pricing
View Details
ASIP, CT (Atypical PKC Isotype-specific-interacting Protein, Bazooka, Baz, CTCL Tumor Antigen se2-5, FLJ21015, Partitioning Defective 3 Homolog, PAR3, PAR-3, PARD3, PARD-3, PAR3alpha, PAR3-alpha, PAR3A, PARD3A, SE2-5L16, SE2-5LT1, SE2-5T2) (PE)
MBS6464263-01 0.2 mL

ASIP, CT (Atypical PKC Isotype-specific-interacting Protein, Bazooka, Baz, CTCL Tumor Antigen se2-5, FLJ21015, Partitioning Defective 3 Homolog, PAR3, PAR-3, PARD3, PARD-3, PAR3alpha, PAR3-alpha, PAR3A, PARD3A, SE2-5L16, SE2-5LT1, SE2-5T2) (PE)

Sign In for Pricing
View Details
ASIP, CT (Atypical PKC Isotype-specific-interacting Protein, Bazooka, Baz, CTCL Tumor Antigen se2-5, FLJ21015, Partitioning Defective 3 Homolog, PAR3, PAR-3, PARD3, PARD-3, PAR3alpha, PAR3-alpha, PAR3A, PARD3A, SE2-5L16, SE2-5LT1, SE2-5T2) (PE)
MBS6464263-02 5x 0.2 mL

ASIP, CT (Atypical PKC Isotype-specific-interacting Protein, Bazooka, Baz, CTCL Tumor Antigen se2-5, FLJ21015, Partitioning Defective 3 Homolog, PAR3, PAR-3, PARD3, PARD-3, PAR3alpha, PAR3-alpha, PAR3A, PARD3A, SE2-5L16, SE2-5LT1, SE2-5T2) (PE)

Sign In for Pricing
View Details
IL-10, Swine
MBS8575427-01 0.005 mg

IL-10, Swine

Sign In for Pricing
View Details