Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS10 Rabbit Polyclonal Antibody (HRP)

INTS10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INT10, C8orf35

UniProt

Q9NVR2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060612

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Capsule InT Filter, PES,0.2μm, Low Bio, Sterile-EtO,2.5",1.5" TC, HB/HB, Bag label
CIKPS0020BESS5TCHH0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Capsule InT Filter, PES,0.2μm, Low Bio, Sterile-EtO,2.5",1.5" TC, HB/HB, Bag label

Sign In for Pricing
View Details
Human C4B qPCR Primer Pair
QH11181S 200 Tests

Human C4B qPCR Primer Pair

Sign In for Pricing
View Details
FOXD3 Rabbit Polyclonal Antibody (PerCP)
orb2284019 100 µL

FOXD3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Human IL1R3 Protein, hFc Tag
orb1291064-01 10 µg

Human IL1R3 Protein, hFc Tag

Sign In for Pricing
View Details
Human IL1R3 Protein, hFc Tag
orb1291064-02 50 µg

Human IL1R3 Protein, hFc Tag

Sign In for Pricing
View Details
Human IL1R3 Protein, hFc Tag
orb1291064-03 100 µg

Human IL1R3 Protein, hFc Tag

Sign In for Pricing
View Details