Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCC Rabbit Polyclonal Antibody (FITC)

IQCC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP4-622L5.6

UniProt

F5H7T8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IQCC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001153514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLC6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV765230 1.0 µg DNA

IGLC6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human Nucleolar transcription factor 1 (UBTF)
AP78265 1 Each

Recombinant Human Nucleolar transcription factor 1 (UBTF)

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ABCB1 / MDR1 / P Glycoprotein
MBS240173-01 0.05 mg

Rabbit Polyclonal to Human ABCB1 / MDR1 / P Glycoprotein

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ABCB1 / MDR1 / P Glycoprotein
MBS240173-02 5x 0.05 mg

Rabbit Polyclonal to Human ABCB1 / MDR1 / P Glycoprotein

Sign In for Pricing
View Details
CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (MaxLight 550)
MBS6289920-01 0.1 mL

CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (MaxLight 550)

Sign In for Pricing
View Details
CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (MaxLight 550)
MBS6289920-02 5x 0.1 mL

CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (MaxLight 550)

Sign In for Pricing
View Details