Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCC Rabbit Polyclonal Antibody (HRP)

IQCC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP4-622L5.6

UniProt

F5H7T8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IQCC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001153514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit
MBS2154417-01 96 Tests

Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit
MBS2154417-02 5x 96 Tests

Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit
MBS2154417-03 10x 96 Tests

Fibroblast Growth Factor 6 (FGF6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
ACVB (Activin B) BioAssayTM ELISA Kit (Sheep) discontinued
369711-01 48 Tests

ACVB (Activin B) BioAssayTM ELISA Kit (Sheep) discontinued

Sign In for Pricing
View Details
ACVB (Activin B) BioAssayTM ELISA Kit (Sheep) discontinued
369711-02 96 Tests

ACVB (Activin B) BioAssayTM ELISA Kit (Sheep) discontinued

Sign In for Pricing
View Details
Lentiviral human PIGX shRNA (UAS) - Lentiviral human PIGX shRNA (UAS) (100)
GTR15324369 1 Vial

Lentiviral human PIGX shRNA (UAS) - Lentiviral human PIGX shRNA (UAS) (100)

Sign In for Pricing
View Details