Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITPRIPL2 Rabbit Polyclonal Antibody (FITC)

ITPRIPL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q3MIP1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITPRIPL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLEGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001030013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit
MBS013855-01 48 Well

Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit
MBS013855-02 96 Well

Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit
MBS013855-03 5x 96 Well

Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit
MBS013855-04 10x 96 Well

Bovine Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Programmed Cell Death 1 Ligand 2 (PDCD1LG2) Antibody (Biotin)
abx347464 0.1 mg

Programmed Cell Death 1 Ligand 2 (PDCD1LG2) Antibody (Biotin)

Sign In for Pricing
View Details
TMEM199 Peptide
DF13885-BP 1 mg

TMEM199 Peptide

Sign In for Pricing
View Details