Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD6 Rabbit Polyclonal Antibody (Biotin)

KBTBD6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q86V97

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KBTBD6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_690867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF1 Rabbit Polyclonal Antibody (FITC)
orb2134510 100 µL

USF1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Zfp955b-set siRNA/shRNA/RNAi Lentivector (Mouse)
51204094 4x 500 ng

Zfp955b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal SMC1 [p Ser966] Antibody [Alexa Fluor 405]
NB100-206AF405 100 µL

Rabbit Polyclonal SMC1 [p Ser966] Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
RPR1B, CT (RPRD1B, C20orf77, CREPT, Regulation of nuclear pre-mRNA domain-containing protein 1B, Cell cycle-related and expression-elevated protein in tumor) (APC) discontinued
041229-APC 200 µL

RPR1B, CT (RPRD1B, C20orf77, CREPT, Regulation of nuclear pre-mRNA domain-containing protein 1B, Cell cycle-related and expression-elevated protein in tumor) (APC) discontinued

Sign In for Pricing
View Details
n-Nonanoic-9,9,9-d3 acid
TRC-N649387-10MG 10 mg

n-Nonanoic-9,9,9-d3 acid

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila araA Protein
VAng-Lsx0665-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Hydrophila araA Protein

Sign In for Pricing
View Details