Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD6 Rabbit Polyclonal Antibody (HRP)

KBTBD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KBTBD6

UniProt

Q86V97

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KBTBD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_690867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit
DLR-NANS-Hu-96T 96 Tests

Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit

Sign In for Pricing
View Details
Artificial Pus Fluid (BZ357) - 200 mL
BZ357-01 200 mL

Artificial Pus Fluid (BZ357) - 200 mL

Sign In for Pricing
View Details
Artificial Pus Fluid (BZ357) - 200 mL
BZ357-02 500 mL

Artificial Pus Fluid (BZ357) - 200 mL

Sign In for Pricing
View Details
Artificial Pus Fluid (BZ357) - 200 mL
BZ357-03 1000 mL

Artificial Pus Fluid (BZ357) - 200 mL

Sign In for Pricing
View Details
EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 650)
126191-ML650 100 µL

EFNA3 (Ephrin-A3, EFL-2, EHK1 Ligand, EHK1-L, EPH-related Receptor Tyrosine Kinase Ligand 3, LERK-3, EFL2, EPLG3, LERK3) (MaxLight 650)

Sign In for Pricing
View Details
RHOC antibody
FNab07284 100 µg

RHOC antibody

Sign In for Pricing
View Details