Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP104 Rabbit Polyclonal Antibody (HRP)

CEP104 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GlyBP, ROC22, JBTS25, CFAP256, KIAA0562

UniProt

O60308

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP104

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055519

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfand3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4791002 1.0 µg DNA

Zfand3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RGS10 Antibody
GWB-FFD019 0.05 mg

RGS10 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Myosin heavy chain 11 Antibody (160) [DyLight 550]
NBP2-89243R 0.1 mL

Rabbit Monoclonal Myosin heavy chain 11 Antibody (160) [DyLight 550]

Sign In for Pricing
View Details
Olr379 Rat siRNA Oligo Duplex (Locus ID 293812)
SR506403 1 Kit

Olr379 Rat siRNA Oligo Duplex (Locus ID 293812)

Sign In for Pricing
View Details
LMO4 Blocking Peptide
MBS9623402-01 1 mg

LMO4 Blocking Peptide

Sign In for Pricing
View Details
LMO4 Blocking Peptide
MBS9623402-02 5x 1 mg

LMO4 Blocking Peptide

Sign In for Pricing
View Details