Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOGA1 Rabbit Polyclonal Antibody (HRP)

SOGA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOGA, KIAA0889, C20orf117

UniProt

O94964

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOGA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCE1 Antibody
A36037-100UL 100 µL

SYCE1 Antibody

Sign In for Pricing
View Details
Rabbit anti-PTPN12 Recombinant Monoclonal Antibody [BL-5-2F8]
A700-007 100 µL (10 Blots)

Rabbit anti-PTPN12 Recombinant Monoclonal Antibody [BL-5-2F8]

Sign In for Pricing
View Details
FGF14 (NM_004115) Human Over-expression Lysate
LS002259-100ug 100 µg

FGF14 (NM_004115) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Olfactory receptor 52B2 (OR52B2) ELISA Kit
GTR10329495 96 Well

Human Olfactory receptor 52B2 (OR52B2) ELISA Kit

Sign In for Pricing
View Details
EVI5L Human qPCR Template Standard (NM_145245)
HK202873 1 Kit

EVI5L Human qPCR Template Standard (NM_145245)

Sign In for Pricing
View Details
L-Homoarginine-d4 Dihydrochloride
sc-280882A 10 mg

L-Homoarginine-d4 Dihydrochloride

Sign In for Pricing
View Details