Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0895L Rabbit Polyclonal Antibody (HRP)

KIAA0895L Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q68EN5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIAA0895L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGHIASKSPCMLVALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Racgap1 shRNA (UAS) - Lentiviral mouse Racgap1 shRNA (UAS, GFP) (100)
GTR15280209 1 Vial

Lentiviral mouse Racgap1 shRNA (UAS) - Lentiviral mouse Racgap1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B9]
TA503384AM 100 µL

Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B9]

Sign In for Pricing
View Details
Multiplex Assay Kit for Neprilysin (CD10), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0028471 96 Tests

Multiplex Assay Kit for Neprilysin (CD10), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgG2a Secondary Antibody [HRP]
NBP2-68489-500ug 500 µg

Goat Polyclonal Goat anti-Rat IgG2a Secondary Antibody [HRP]

Sign In for Pricing
View Details
Olr114 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7433403 1.0 µg DNA

Olr114 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal BTBD15 Antibody [DyLight 755]
NBP1-78185IR 0.1 mL

Rabbit Polyclonal BTBD15 Antibody [DyLight 755]

Sign In for Pricing
View Details