Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1324L Rabbit Polyclonal Antibody (HRP)

KIAA1324L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIG121L, KIAA1324L

UniProt

A8MWY0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIAA1324L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSNKPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMG3 (NM_001134340) Human Over-expression Lysate
LC427395 20 µg

PSMG3 (NM_001134340) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9361886-01 48 Well

Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9361886-02 96 Well

Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9361886-03 5x 96 Well

Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit
MBS9361886-04 10x 96 Well

Canine SH3 Domain-Containing YSC84-Like Protein 1 (SH3YL1) ELISA Kit

Sign In for Pricing
View Details
GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)
MBS6303595-01 0.1 mL

GPM6A, CT (GPM6A, M6A, Neuronal membrane glycoprotein M6-a) (MaxLight 405)

Sign In for Pricing
View Details