Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIRMA Rabbit Polyclonal Antibody (FITC)

VIRMA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSTP054, fSAP121, KIAA1429

UniProt

Q69YN4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA1429

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_892121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L6 Cell Line
RWT-662 1x 10^6

L6 Cell Line

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)
MBS1482690-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)
MBS1482690-02 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)
MBS1482690-03 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)
MBS1482690-04 0.1 mg (Yeast)

Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)
MBS1482690-05 0.02 mg (Baculovirus)

Recombinant Streptococcus agalactiae serotype Ia Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details