Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1522 Rabbit Polyclonal Antibody (HRP)

KIAA1522 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9P206

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA1522

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQDRTKRELAENGGVLQLVG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

112kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_065939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEH1 (Melanoma Antigen Family H, 1, APR-1, APR1, MAGEH)
248410 50 µL

MAGEH1 (Melanoma Antigen Family H, 1, APR-1, APR1, MAGEH)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)
MBS1161883-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)
MBS1161883-02 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)
MBS1161883-03 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)
MBS1161883-04 0.1 mg (Yeast)

Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)
MBS1161883-05 0.02 mg (Baculovirus)

Recombinant Acinetobacter baumannii Cell division topological specificity factor (minE)

Sign In for Pricing
View Details