Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP74 Rabbit Polyclonal Antibody (FITC)

CFAP74 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C1orf222, KIAA1751

UniProt

Q9C0B2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA1751

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AATSFSEQQLEGTESSQADMQSRKELEKLDKEQEEEQPAGEPGCQAKPGW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NET5 (Transmembrane Protein 201, Spindle-associated Membrane Protein 1, TMEM201, SAMP1) (AP)
MBS6269869-01 0.1 mL

NET5 (Transmembrane Protein 201, Spindle-associated Membrane Protein 1, TMEM201, SAMP1) (AP)

Sign In for Pricing
View Details
NET5 (Transmembrane Protein 201, Spindle-associated Membrane Protein 1, TMEM201, SAMP1) (AP)
MBS6269869-02 5x 0.1 mL

NET5 (Transmembrane Protein 201, Spindle-associated Membrane Protein 1, TMEM201, SAMP1) (AP)

Sign In for Pricing
View Details
PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (HRP)
MBS6433870-01 0.1 mL

PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (HRP)

Sign In for Pricing
View Details
PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (HRP)
MBS6433870-02 5x 0.1 mL

PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (HRP)

Sign In for Pricing
View Details
MDM2 Rabbit Polyclonal Antibody (RBITC)
orb1083723 100 µL

MDM2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
NGB (Neuroglobin) (Biotin)
130351-Biotin 100 µL

NGB (Neuroglobin) (Biotin)

Sign In for Pricing
View Details