Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD4 Rabbit Polyclonal Antibody (HRP)

MSANTD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1826

UniProt

Q8NCY6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MSANTD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOGA1 Antibody
orb620076 100 µL

SOGA1 Antibody

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG (H+L), Human/Rat/Mouse ads-HRP
MBS674965-01 1 mL

Donkey Anti-Rabbit IgG (H+L), Human/Rat/Mouse ads-HRP

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG (H+L), Human/Rat/Mouse ads-HRP
MBS674965-02 5x 1 mL

Donkey Anti-Rabbit IgG (H+L), Human/Rat/Mouse ads-HRP

Sign In for Pricing
View Details
Adiponectin Rabbit Polyclonal Antibody (PE-Cy7)
orb917657 100 µL

Adiponectin Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2)
I8426-33E 100 µg

Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2)

Sign In for Pricing
View Details
LDLRAD1 Protein Vector (Mouse) (pPM-C-His)
PV196241 500 ng

LDLRAD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details