Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA2013 Rabbit Polyclonal Antibody (Biotin)

KIAA2013 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8IYS2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA2013

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TDTHTPSGLTVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), 1mg/mL
BNUM1947-50 1x 50 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), 1mg/mL

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF568 conjugate, 0.1mg/mL
BNC681573-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF568 conjugate, 0.1mg/mL
BNC682598-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse GLIPR1 Protein (His Tag)
PKSM040455 100 µg

Recombinant Mouse GLIPR1 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF640R conjugate, 0.1mg/mL
BNC402148-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR22 Antibody
8G330-AAT 50 µg

GPR22 Antibody

Sign In for Pricing
View Details