Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA2013 Rabbit Polyclonal Antibody (FITC)

KIAA2013 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8IYS2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA2013

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDTHTPSGLTVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTA (NM_000595) Human Over-expression Lysate
LC424627 20 µg

LTA (NM_000595) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXO7 Human qPCR Primer Pair (NM_012179)
HP233788 200 Reactions

FBXO7 Human qPCR Primer Pair (NM_012179)

Sign In for Pricing
View Details
Fxyd2 (BC024614) Mouse Tagged ORF Clone
MG200074 10 µg

Fxyd2 (BC024614) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human CABLES2 activation kit by CRISPRa
GA113154 1 Kit

Human CABLES2 activation kit by CRISPRa

Sign In for Pricing
View Details
CTLA4 Rabbit Polyclonal Antibody
TA366792 100 µL

CTLA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]
CF807285 100 µg

Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]

Sign In for Pricing
View Details