Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Rat (His-SUMO)

The GFER protein is a FAD-dependent sulfhydryl oxidase that restores redox-active disulfide bonds in CHCHD4/MIA40, an important partner for protein folding in the mitochondrial intermembrane space.GFER Protein, Rat (His-SUMO) is the recombinant rat-derived GFER protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Rat (His-SUMO), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-rat-his-sumo.html

Smiles

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Molecular Formula

27100 (Gene_ID) Q63042 (M1-D198) (Accession)

Molecular Weight

Approximately 38.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propylene Glycol Dicaprate
TRC-P797145-10MG 10 mg

Propylene Glycol Dicaprate

Sign In for Pricing
View Details
Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-H0033-01 24 Tests

Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-H0033-02 48 Tests

Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-H0033-03 96 Tests

Mini Sample Human KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Air Cooled Chiller BCHI-105
BCHI-105 Each

Air Cooled Chiller BCHI-105

Sign In for Pricing
View Details
Indole-2,4,5,6,7-d5-3-acetic Acid
TRC-I577344-1MG 1 mg

Indole-2,4,5,6,7-d5-3-acetic Acid

Sign In for Pricing
View Details