Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT72 Rabbit Polyclonal Antibody (FITC)

KRT72 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

K72, KRT6, CK-72, K6irs, K6IRS2, KRT6IRS2

UniProt

Q14CN4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT72

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_542785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM11 Rabbit Polyclonal Antibody
E53P10034 100 µL

ADAM11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R4 (Serine/Threonine-protein Phosphatase 2A Activator, PP2A, Subunit B', PR53 Isoform, Phosphotyrosyl Phosphatase Activator, PTPA, Serine/Threonine-protein Phosphatase 2A Regulatory Subunit 4, Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B', PTPA) (AP) discontinued
P9107-48-AP 100 µL

PPP2R4 (Serine/Threonine-protein Phosphatase 2A Activator, PP2A, Subunit B', PR53 Isoform, Phosphotyrosyl Phosphatase Activator, PTPA, Serine/Threonine-protein Phosphatase 2A Regulatory Subunit 4, Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B', PTPA) (AP) discontinued

Sign In for Pricing
View Details
Yersinia pestis v antigen (Va68)
sc-52307 100 µg/mL

Yersinia pestis v antigen (Va68)

Sign In for Pricing
View Details
Human Obestatin (OB) ELISA Kit
MBS2704101-01 24 Strip Well

Human Obestatin (OB) ELISA Kit

Sign In for Pricing
View Details
Human Obestatin (OB) ELISA Kit
MBS2704101-02 48 Well

Human Obestatin (OB) ELISA Kit

Sign In for Pricing
View Details
Human Obestatin (OB) ELISA Kit
MBS2704101-03 96 Well

Human Obestatin (OB) ELISA Kit

Sign In for Pricing
View Details