Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT72 Rabbit Polyclonal Antibody (HRP)

KRT72 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K72, KRT6, CK-72, K6irs, K6IRS2, KRT6IRS2

UniProt

Q14CN4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT72

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_542785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMP 22 rapid test
GENMP22-102a 25 Tests/Box

NMP 22 rapid test

Sign In for Pricing
View Details
Recombinant Human ATAD2 Protein, N-His
YHJ07602 100 μg

Recombinant Human ATAD2 Protein, N-His

Sign In for Pricing
View Details
CD63 (gp55, granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Mast cell antigen AD1, melanoma 1 antigen, Melanoma-associated antigen MLA1, Melanoma-associated antigen ME491, MLA1, NGA, Ocular melanoma-associated antigen, OMA81H, PTLGP40, Tetraspanin-30, TSPAN30) (BSA & Azide Free) (MaxLight 550)
168712-AF-ML550 100 µL

CD63 (gp55, granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Mast cell antigen AD1, melanoma 1 antigen, Melanoma-associated antigen MLA1, Melanoma-associated antigen ME491, MLA1, NGA, Ocular melanoma-associated antigen, OMA81H, PTLGP40, Tetraspanin-30, TSPAN30) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
BTN3A1 Recombinant Protein Fc Tag Lyophilized
MBS8430705-01 0.1 mg

BTN3A1 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
BTN3A1 Recombinant Protein Fc Tag Lyophilized
MBS8430705-02 5x 0.1 mg

BTN3A1 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Mouse TUBb1 ELISA Kit
orb442778-01 48 Tests

Mouse TUBb1 ELISA Kit

Sign In for Pricing
View Details