Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT78 Rabbit Polyclonal Antibody (HRP)

KRT78 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K5B, K78, Kb40, CK-78

UniProt

Q8N1N4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KRT78

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARTN shRNA (UAS) - Lentiviral human ARTN shRNA (UAS, RFP) (100)
GTR15113352 1 Vial

Lentiviral human ARTN shRNA (UAS) - Lentiviral human ARTN shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Dnase1l1 (NM_001014223) Rat Tagged ORF Clone Lentiviral Particle
RR209252L3V 200 µL

Dnase1l1 (NM_001014223) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human FGF10 ELISA Kit
ELA-E1882h 96 Tests

Human FGF10 ELISA Kit

Sign In for Pricing
View Details
Actinomycin D
orb3066658-01 5 mg

Actinomycin D

Sign In for Pricing
View Details
Actinomycin D
orb3066658-02 25 mg

Actinomycin D

Sign In for Pricing
View Details
Rpl27 ORF Vector (Rat) (pORF)
41269016 1.0 µg DNA

Rpl27 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details