Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT78 Rabbit Polyclonal Antibody (HRP)

KRT78 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K5B, K78, Kb40, CK-78

UniProt

Q8N1N4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KRT78

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmeff2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3684502 1.0 µg DNA

Tmeff2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PAK3 Rabbit Polyclonal Antibody (HRP)
orb2618519 100 µg

PAK3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Apg10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5991R-BF594 100 µL

Apg10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Bovine Olfactory receptor 6C75 (OR6C75) ELISA kit
GTR10427040 96 Well

Bovine Olfactory receptor 6C75 (OR6C75) ELISA kit

Sign In for Pricing
View Details
Lentiviral human CLIP4 shRNA (UAS) - Lentiviral human CLIP4 shRNA (UAS) (25)
GTR15321272 1 Vial

Lentiviral human CLIP4 shRNA (UAS) - Lentiviral human CLIP4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Heparan-sulfate 6-O-sulfotransferase 3 (HS6ST3) ELISA Kit
MBS7219348-01 48 Well

Mouse Heparan-sulfate 6-O-sulfotransferase 3 (HS6ST3) ELISA Kit

Sign In for Pricing
View Details