Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRTCAP2 Rabbit Polyclonal Antibody (Biotin)

KRTCAP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KCP2

UniProt

Q8N6L1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRTCAP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEMIN2 Rabbit Monoclonal Antibody [Clone ID: 23GB5835]
TA424808S 20 µL

GEMIN2 Rabbit Monoclonal Antibody [Clone ID: 23GB5835]

Sign In for Pricing
View Details
TRIM29 AAV Vector (Mouse) (CMV)
47763104 1 µg

TRIM29 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Sentrin 1, NT (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SUMO-1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, U
MBS6498883-01 0.1 mL

Sentrin 1, NT (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SUMO-1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, U

Sign In for Pricing
View Details
Sentrin 1, NT (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SUMO-1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, U
MBS6498883-02 5x 0.1 mL

Sentrin 1, NT (Sentrin, GAP Modifying Protein 1, GMP1, PIC1, PIC-1, Small Ubiquitin-related Modifier 1, SUMO1, SUMO-1, SMT3, SMT3 Homolog 3, SMT3 Suppressor of Mif Two 3 Homolog 1, SMT3C, SMT3H3, Ubiquitin Homology Domain Protein PIC1, Ubiquitin-like 1, U

Sign In for Pricing
View Details
PCDH7 Rabbit Polyclonal Antibody (Biotin)
orb453822 100 µL

PCDH7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_308 (MPN_308), partial
MBS1174284-01 1 mg (E-Coli)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_308 (MPN_308), partial

Sign In for Pricing
View Details