Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP5L Rabbit Polyclonal Antibody (HRP)

LRP5L Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A4QPB2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRP5L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WHAMMP3 (NM_001045545) Human Over-expression Lysate
LY420755 100 µg

WHAMMP3 (NM_001045545) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DEFB105B activation kit by CRISPRa
GA118605 1 Kit

Human DEFB105B activation kit by CRISPRa

Sign In for Pricing
View Details
1-(3-Pyridyl)-1-butanol-4-carboxylic Acid Na+/NH4+ Salt
TRC-P992550-10MG 10 mg

1-(3-Pyridyl)-1-butanol-4-carboxylic Acid Na+/NH4+ Salt

Sign In for Pricing
View Details
NGLY1 Human Gene Knockout Kit (CRISPR)
KN203447RB 1 Kit

NGLY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLN5 Human Gene Knockout Kit (CRISPR)
KN214709 1 Kit

CLN5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB3A Mouse Monoclonal Antibody [Clone ID: OTI5C12]
CF809539 100 µg

RAB3A Mouse Monoclonal Antibody [Clone ID: OTI5C12]

Sign In for Pricing
View Details