Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC14B Rabbit Polyclonal Antibody (Biotin)

LRRC14B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NHZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRC14B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SCN2B shRNA (UAS) - Lentiviral human SCN2B shRNA (UAS, GFP) plasmid
GTR15345517 1 Vial

Lentiviral human SCN2B shRNA (UAS) - Lentiviral human SCN2B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RING Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF) (MaxLight 650)
MBS6224348-01 0.1 mL

RING Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF) (MaxLight 650)

Sign In for Pricing
View Details
RING Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF) (MaxLight 650)
MBS6224348-02 5x 0.1 mL

RING Finger Protein 13 (RNF13, E3 Ubiquitin-protein Ligase RNF13, RZF) (MaxLight 650)

Sign In for Pricing
View Details
Anti-KLHL12 antibody
STJ98202 100 µl

Anti-KLHL12 antibody

Sign In for Pricing
View Details
Rat Anti-Mouse CD23 mAb (FITC) [B3B4]
E2781706 100 Tests

Rat Anti-Mouse CD23 mAb (FITC) [B3B4]

Sign In for Pricing
View Details
LTBR (NM_002342) Human Over-expression Lysate
LC400841 20 µg

LTBR (NM_002342) Human Over-expression Lysate

Sign In for Pricing
View Details