Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC14B Rabbit Polyclonal Antibody (Biotin)

LRRC14B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NHZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRC14B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2S2, CT (EIF2S2, EIF2B, Eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta) (MaxLight 650)
MBS6294948-01 0.1 mL

EIF2S2, CT (EIF2S2, EIF2B, Eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta) (MaxLight 650)

Sign In for Pricing
View Details
EIF2S2, CT (EIF2S2, EIF2B, Eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta) (MaxLight 650)
MBS6294948-02 5x 0.1 mL

EIF2S2, CT (EIF2S2, EIF2B, Eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human BCL2L2 shRNA (UAS) - Lentiviral human BCL2L2 shRNA (UAS, iRFP) (25)
GTR15110030 1 Vial

Lentiviral human BCL2L2 shRNA (UAS) - Lentiviral human BCL2L2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Chicken Transgelin (TAGLN) ELISA Kit
AE16375CH-01 48 Tests

Chicken Transgelin (TAGLN) ELISA Kit

Sign In for Pricing
View Details
Chicken Transgelin (TAGLN) ELISA Kit
AE16375CH-02 96 Tests

Chicken Transgelin (TAGLN) ELISA Kit

Sign In for Pricing
View Details
ARHGEF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
12330111 3x 1.0 µg

ARHGEF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details