Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEB10 Rabbit Polyclonal Antibody (HRP)

MAGEB10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96LZ2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAGEB10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_872312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Htr5a ELISA Kit
ELI-35033r 96 Tests

Rat Htr5a ELISA Kit

Sign In for Pricing
View Details
SLC39A7 Rabbit Polyclonal Antibody (Cy7)
orb1085132 100 µL

SLC39A7 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
PINX1 Antibody - middle region
ARP87624_P050-25UL 25 µL

PINX1 Antibody - middle region

Sign In for Pricing
View Details
Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) plasmid
GTR15150031 1 Vial

Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PDGFR (PDGFRB, PDGFR, PDGFR1, Platelet-derived growth factor receptor beta, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, Platelet-derived growth factor receptor 1, CD_antigen=CD140b)
031182 100 µL

PDGFR (PDGFRB, PDGFR, PDGFR1, Platelet-derived growth factor receptor beta, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, Platelet-derived growth factor receptor 1, CD_antigen=CD140b)

Sign In for Pricing
View Details
Mouse Monoclonal SREBP2 Antibody (SREBP2/1580) [Alexa Fluor 594]
NBP3-14186AF594 0.1 mL

Mouse Monoclonal SREBP2 Antibody (SREBP2/1580) [Alexa Fluor 594]

Sign In for Pricing
View Details