Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1IP1L Rabbit Polyclonal Antibody (FITC)

MAPK1IP1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MISS, C14orf32, c14_5346

UniProt

Q8NDC0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAPK1IP1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_653179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADGRL4 sgRNA gene knockout kit - Lentiviral human ADGRL4 sgRNA gene knockout kit (plasmid)
GTR15359360 1 Vial

Lentiviral human ADGRL4 sgRNA gene knockout kit - Lentiviral human ADGRL4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit
MBS452182-01 48 Tests

Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit

Sign In for Pricing
View Details
Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit
MBS452182-02 96 Tests

Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit

Sign In for Pricing
View Details
Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit
MBS452182-03 5x 96 Tests

Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit

Sign In for Pricing
View Details
Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit
MBS452182-04 10x 96 Tests

Human Polyamine Modulated Factor 1 Binding Protein 1 (PMFBP1) ELISA Kit

Sign In for Pricing
View Details
KCNMA1 Protein Vector (Rat) (pPM-C-His)
PV275889 500 ng

KCNMA1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details