Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1IP1L Rabbit Polyclonal Antibody (HRP)

MAPK1IP1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MISS, C14orf32, c14_5346

UniProt

Q8NDC0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAPK1IP1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_653179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB12 (DnaJ Homolog Subfamily B Member 12, DJ10) (FITC)
MBS6414344-01 0.1 mL

DNAJB12 (DnaJ Homolog Subfamily B Member 12, DJ10) (FITC)

Sign In for Pricing
View Details
DNAJB12 (DnaJ Homolog Subfamily B Member 12, DJ10) (FITC)
MBS6414344-02 5x 0.1 mL

DNAJB12 (DnaJ Homolog Subfamily B Member 12, DJ10) (FITC)

Sign In for Pricing
View Details
Cryptosporidium Parvum
474231 100 µL

Cryptosporidium Parvum

Sign In for Pricing
View Details
Lentiviral mouse Vamp4 shRNA (UAS) - Lentiviral mouse Vamp4 shRNA (UAS) (100)
GTR15224526 1 Vial

Lentiviral mouse Vamp4 shRNA (UAS) - Lentiviral mouse Vamp4 shRNA (UAS) (100)

Sign In for Pricing
View Details
SC11A Rabbit Polyclonal Antibody (APC-Cy7)
orb2491762 100 µL

SC11A Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Mouse Mir3060 qPCR Primer Pair
QM79614S 200 Tests

Mouse Mir3060 qPCR Primer Pair

Sign In for Pricing
View Details