Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFR1 Rabbit Polyclonal Antibody (Biotin)

SFR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MEI5, MEIR5, C10orf78, bA373N18.1

UniProt

Q86XK3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SFR1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAIR1 Protein Vector (Mouse) (pPM-C-His)
PV195709 500 ng

LAIR1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase XIV Antibody, Rabbit Polyclonal
MBS8110769-01 0.1 mL

Anti-Carbonic Anhydrase XIV Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase XIV Antibody, Rabbit Polyclonal
MBS8110769-02 5x 0.1 mL

Anti-Carbonic Anhydrase XIV Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
AGR2, NT (AGR2, AG2, Anterior gradient protein 2 homolog, HPC8, Secreted cement gland protein XAG-2 homolog) (FITC)
MBS6272292-01 0.2 mL

AGR2, NT (AGR2, AG2, Anterior gradient protein 2 homolog, HPC8, Secreted cement gland protein XAG-2 homolog) (FITC)

Sign In for Pricing
View Details
AGR2, NT (AGR2, AG2, Anterior gradient protein 2 homolog, HPC8, Secreted cement gland protein XAG-2 homolog) (FITC)
MBS6272292-02 5x 0.2 mL

AGR2, NT (AGR2, AG2, Anterior gradient protein 2 homolog, HPC8, Secreted cement gland protein XAG-2 homolog) (FITC)

Sign In for Pricing
View Details
Human NACA2 Protein Lysate
MBS8415755-01 0.02 mg

Human NACA2 Protein Lysate

Sign In for Pricing
View Details