Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFR1 Rabbit Polyclonal Antibody (FITC)

SFR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MEI5, MEIR5, C10orf78, bA373N18.1

UniProt

Q86XK3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPAS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit
MBS9340912-01 48 Well

Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit
MBS9340912-02 96 Well

Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit
MBS9340912-03 5x 96 Well

Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit
MBS9340912-04 10x 96 Well

Human Putative uncharacterized protein CXorf28, CXorf28 ELISA Kit

Sign In for Pricing
View Details
1110059E24Rik ORF Vector (Mouse) (pORF)
ORF036613 1.0 µg DNA

1110059E24Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Hemoglobin alpha Antibody / HBA
V5569-20UG 20 µg

Recombinant Hemoglobin alpha Antibody / HBA

Sign In for Pricing
View Details