Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL17 Rabbit Polyclonal Antibody (HRP)

METTL17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

METT11D1

UniProt

Q9H7H0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073571

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amyloid Protein-binding Protein 2 (Amyloid beta Precursor Protein-binding Protein 2, APPBP2, APP-BP2, HS.84084, KIAA0228, Protein Interacting with APP Tail 1, PAT1) (MaxLight 750) discontinued
A2275-95-ML750 100 µL

Amyloid Protein-binding Protein 2 (Amyloid beta Precursor Protein-binding Protein 2, APPBP2, APP-BP2, HS.84084, KIAA0228, Protein Interacting with APP Tail 1, PAT1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPL7L1 Antibody
OACA05021-50UG 50 µg

RPL7L1 Antibody

Sign In for Pricing
View Details
Usp26 Mouse shRNA Lentiviral Particle (Locus ID 83563)
TL505420V 500 µL Each

Usp26 Mouse shRNA Lentiviral Particle (Locus ID 83563)

Sign In for Pricing
View Details
PRDM12 Antibody
AM1195a 400 µL

PRDM12 Antibody

Sign In for Pricing
View Details
Trans-caffeic acid
M31281-01 50 mg

Trans-caffeic acid

Sign In for Pricing
View Details
Trans-caffeic acid
M31281-02 100 mg

Trans-caffeic acid

Sign In for Pricing
View Details