Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTK2 Rabbit Polyclonal Antibody (HRP)

PTK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK

UniProt

Q05397

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human PTK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IELGRC' target='_blank'>SEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC67 Rabbit Polyclonal Antibody (BF680)
orb2480637 100 µL

LRRC67 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Atp6v0e2 Rat shRNA Plasmid (Locus ID 436582)
TR700438 1 Kit

Atp6v0e2 Rat shRNA Plasmid (Locus ID 436582)

Sign In for Pricing
View Details
Recombinant Rat Rh Associated Glycoprotein (RHAG)
RPU50537-01 50 µg

Recombinant Rat Rh Associated Glycoprotein (RHAG)

Sign In for Pricing
View Details
Recombinant Rat Rh Associated Glycoprotein (RHAG)
RPU50537-02 100 µg

Recombinant Rat Rh Associated Glycoprotein (RHAG)

Sign In for Pricing
View Details
Recombinant Rat Rh Associated Glycoprotein (RHAG)
RPU50537-03 1 mg

Recombinant Rat Rh Associated Glycoprotein (RHAG)

Sign In for Pricing
View Details
Others Antibody
orb3169683-01 1 mg

Others Antibody

Sign In for Pricing
View Details