Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL2 Rabbit Polyclonal Antibody (Biotin)

MRPL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI-22, RPML14, MRP-L14

UniProt

Q5T653

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_057034

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ENKUR Pre-designed siRNA Set B
SI004977B 1 Each

Human ENKUR Pre-designed siRNA Set B

Sign In for Pricing
View Details
Aldehyde Dehydrogenase family 8 member A1 (ALDH8A1) Human ELISA Kit
B3694 96 Tests

Aldehyde Dehydrogenase family 8 member A1 (ALDH8A1) Human ELISA Kit

Sign In for Pricing
View Details
AG 126
sc-3528 5 mg

AG 126

Sign In for Pricing
View Details
Sumo3 (NM_001301671) Mouse Untagged Clone
MC225682 10 µg

Sumo3 (NM_001301671) Mouse Untagged Clone

Sign In for Pricing
View Details
Human Tigger transposable element-derived protein 1, TIGD1 ELISA Kit
MBS9333083-01 48 Well

Human Tigger transposable element-derived protein 1, TIGD1 ELISA Kit

Sign In for Pricing
View Details
Human Tigger transposable element-derived protein 1, TIGD1 ELISA Kit
MBS9333083-02 96 Well

Human Tigger transposable element-derived protein 1, TIGD1 ELISA Kit

Sign In for Pricing
View Details