Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL30 Rabbit Polyclonal Antibody (FITC)

MRPL30 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L28MT, L30MT, MRPL28, RPML28, MRP-L28, MRP-L30, MRPL28M

UniProt

Q8TCC3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL30

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660213

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum-free Medium (ready-to-use) for adherent cells
4032 mL500 500 mL

Serum-free Medium (ready-to-use) for adherent cells

Sign In for Pricing
View Details
EPHA5 (Ephrin Type-A Receptor 5, Tyrosine-protein Kinase Receptor EHK-1, Eph Homology Kinase-1, Receptor Protein-tyrosine Kinase HEK7, EPH-like Kinase 7, EK7, EHK1, HEK7) (MaxLight 750)
MBS6231054-01 0.1 mL

EPHA5 (Ephrin Type-A Receptor 5, Tyrosine-protein Kinase Receptor EHK-1, Eph Homology Kinase-1, Receptor Protein-tyrosine Kinase HEK7, EPH-like Kinase 7, EK7, EHK1, HEK7) (MaxLight 750)

Sign In for Pricing
View Details
EPHA5 (Ephrin Type-A Receptor 5, Tyrosine-protein Kinase Receptor EHK-1, Eph Homology Kinase-1, Receptor Protein-tyrosine Kinase HEK7, EPH-like Kinase 7, EK7, EHK1, HEK7) (MaxLight 750)
MBS6231054-02 5x 0.1 mL

EPHA5 (Ephrin Type-A Receptor 5, Tyrosine-protein Kinase Receptor EHK-1, Eph Homology Kinase-1, Receptor Protein-tyrosine Kinase HEK7, EPH-like Kinase 7, EK7, EHK1, HEK7) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit anti-STAT5a Recombinant Monoclonal Antibody [BLR124H]
A700-124CF 100 µg

Rabbit anti-STAT5a Recombinant Monoclonal Antibody [BLR124H]

Sign In for Pricing
View Details
Human Protease Activated Receptor 1 ELISA Kit
MBS733919-01 48 Well

Human Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Protease Activated Receptor 1 ELISA Kit
MBS733919-02 96 Well

Human Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details