Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL30 Rabbit Polyclonal Antibody (HRP)

MRPL30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L28MT, L30MT, MRPL28, RPML28, MRP-L28, MRP-L30, MRPL28M

UniProt

Q8TCC3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660213

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacng6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7060706 1.0 µg DNA

Cacng6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-eIF4A1 Rabbit pAb
GB11719-50 50 μL

Anti-eIF4A1 Rabbit pAb

Sign In for Pricing
View Details
C19orf6 Protein Vector (Human) (pPB-C-His)
PV005493 500 ng

C19orf6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Bovine Sex-determining region Y protein ELISA Kit
MBS289816-01 48 Well

Bovine Sex-determining region Y protein ELISA Kit

Sign In for Pricing
View Details
Bovine Sex-determining region Y protein ELISA Kit
MBS289816-02 96 Well

Bovine Sex-determining region Y protein ELISA Kit

Sign In for Pricing
View Details
Bovine Sex-determining region Y protein ELISA Kit
MBS289816-03 5x 96 Well

Bovine Sex-determining region Y protein ELISA Kit

Sign In for Pricing
View Details