Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL52 Rabbit Polyclonal Antibody (Biotin)

MRPL52 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q86TS9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL52

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-RAD23A (Ser357) Polyclonal Antibody
TMAC-03506-01 50 μL

Anti-Phospho-RAD23A (Ser357) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-RAD23A (Ser357) Polyclonal Antibody
TMAC-03506-02 100 µL

Anti-Phospho-RAD23A (Ser357) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human CLEC19A sgRNA gene knockout kit - Lentiviral human CLEC19A sgRNA gene knockout kit (plasmid)
GTR15380918 1 Vial

Lentiviral human CLEC19A sgRNA gene knockout kit - Lentiviral human CLEC19A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CD160 Rabbit Polyclonal Antibody (Cy5.5)
orb1049574 100 µL

CD160 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
S100Z 3'UTR GFP Stable Cell Line
TU072544 1.0 mL

S100Z 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-His
orb2831059-01 20 µg

Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-His

Sign In for Pricing
View Details