Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS5 Rabbit Polyclonal Antibody (FITC)

MRPS5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S5mt, MRP-S5

UniProt

P82675

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPS5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEAD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS41 Human Gene Knockout Kit (CRISPR)
KN207267RB 1 Kit

VPS41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rhPTH (1-30) Trifluoroacetic Acid Salt Hydrate
TRC-R315095-5MG 5 mg

rhPTH (1-30) Trifluoroacetic Acid Salt Hydrate

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL
BNCB2054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Neural tissue
CS710300 5x 5 µm

Tissue FFPE Sections, Neural tissue

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3117), CF514 conjugate, 0.1mg/mL
BNC143117-500 1x 500 µL

CD19 (B-Lymphocyte Marker) (CD19/3117), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-SMAD2 (S465+467) Recombinant Rabbit Monoclonal Antibody [PSH05-76]
HA722443 100 µL

Phospho-SMAD2 (S465+467) Recombinant Rabbit Monoclonal Antibody [PSH05-76]

Sign In for Pricing
View Details