Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS5 Rabbit Polyclonal Antibody (HRP)

MRPS5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S5mt, MRP-S5

UniProt

P82675

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPS5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEAD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLBP (FABP7) Human Over-expression Lysate
orb1364877 20 µg

BLBP (FABP7) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GPR52 Knockout HEK293T cell line
GTR15410650 1 Vial

Human GPR52 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-NRG1 Antibody Picoband® (Dylight488 Conjugate)
PA1969-Dylight488 100 µg

Anti-NRG1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Mouse ESM1 Recombinant Protein (C-Fc)
MV589021-01 50 µg

Mouse ESM1 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse ESM1 Recombinant Protein (C-Fc)
MV589021-02 100 µg

Mouse ESM1 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse ESM1 Recombinant Protein (C-Fc)
MV589021-03 1 mg

Mouse ESM1 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details