Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Rabbit Polyclonal Antibody (Biotin)

MRPS18C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI-134, S18mt-c, MRPS18-1, mrps18-c, MRP-S18-1, MRP-S18-c

UniProt

Q9Y3D5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS18C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit
MBS2500924-01 24 Tests

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit

Sign In for Pricing
View Details
Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit
MBS2500924-02 48 Tests

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit

Sign In for Pricing
View Details
Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit
MBS2500924-03 96 Tests

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit

Sign In for Pricing
View Details
Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit
MBS2500924-04 5x 96 Tests

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit

Sign In for Pricing
View Details
Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit
MBS2500924-05 10x 96 Tests

Porcine SNRPD1 (Small Nuclear Ribonucleoprotein Polypeptide D1) ELISA Kit

Sign In for Pricing
View Details
PPA2 Human
OM298778-01 20 µg

PPA2 Human

Sign In for Pricing
View Details