Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Rabbit Polyclonal Antibody (HRP)

MRPS18C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI-134, S18mt-c, MRPS18-1, mrps18-c, MRP-S18-1, MRP-S18-c

UniProt

Q9Y3D5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS18C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Notum (NM_001013975) Rat Tagged ORF Clone
RR201090 10 µg

Notum (NM_001013975) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ANGPTL3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62299R-BF350-01 20 µL

ANGPTL3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ANGPTL3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62299R-BF350-02 100 µL

ANGPTL3 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Moisture Analyzer (BFU-5701)
BFU-5701 1 Unit

Moisture Analyzer (BFU-5701)

Sign In for Pricing
View Details
ADPRH Adenovirus (Mouse)
11440054 1.0 mL

ADPRH Adenovirus (Mouse)

Sign In for Pricing
View Details
Human HLA-F Knockout HEK293T cell line
GTR15417529 1 Vial

Human HLA-F Knockout HEK293T cell line

Sign In for Pricing
View Details