Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS36 Rabbit Polyclonal Antibody (HRP)

MRPS36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DC47, MRP-S36

UniProt

P82909

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MRPS36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_150597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lasalocid A Sodium Salt (solution in acetonitrile 0.2mg/2ml) discontinued. See L1370-01
015501 1 mL

Lasalocid A Sodium Salt (solution in acetonitrile 0.2mg/2ml) discontinued. See L1370-01

Sign In for Pricing
View Details
GAPDH Mouse Monoclonal Antibody
AF2819-50μl 50 µL

GAPDH Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)
MBS1179912-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)
MBS1179912-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)
MBS1179912-03 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)
MBS1179912-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized oxidoreductase YfiI (yfiI)

Sign In for Pricing
View Details