Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS36 Rabbit Polyclonal Antibody (Biotin)

MRPS36 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DC47, MRP-S36

UniProt

P82909

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPS36

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_150597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optional eight channel adapter, fine tip stainless steel
V1002-S8 1 Each

Optional eight channel adapter, fine tip stainless steel

Sign In for Pricing
View Details
Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2510279-01 24 Tests

Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2510279-02 48 Tests

Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2510279-03 96 Tests

Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2510279-04 5x 96 Tests

Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2510279-05 10x 96 Tests

Rabbit UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details