Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYADML2 Rabbit Polyclonal Antibody (HRP)

MYADML2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NDP7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYADML2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVYTFLAVLLYLSAAVIWPVFCFDPKYGEPKRPPNCARGSCPWDSQLVVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DAP1 Antibody [mFluor Violet 610 SE]
NBP2-82082MFV610 0.1 mL

Rabbit Polyclonal DAP1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lentiviral mouse Krt9 shRNA (UAS) - Lentiviral mouse Krt9 shRNA (UAS) (100)
GTR15196734 1 Vial

Lentiviral mouse Krt9 shRNA (UAS) - Lentiviral mouse Krt9 shRNA (UAS) (100)

Sign In for Pricing
View Details
RBMS1 (73-K2)
sc-101190 100 µg/mL

RBMS1 (73-K2)

Sign In for Pricing
View Details
Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit
MBS9919708-01 48 Well

Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit

Sign In for Pricing
View Details
Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit
MBS9919708-02 96 Well

Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit

Sign In for Pricing
View Details
Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit
MBS9919708-03 5x 96 Well

Porcine Syntaxin Binding Protein 5-Like (STXBP5L) ELISA Kit

Sign In for Pricing
View Details