Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYLK4 Rabbit Polyclonal Antibody (FITC)

MYLK4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SgK085

UniProt

Q86YV6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYLK4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001012418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB3, NT (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (AP)
MBS6474432-01 0.2 mL

EphB3, NT (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (AP)

Sign In for Pricing
View Details
EphB3, NT (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (AP)
MBS6474432-02 5x 0.2 mL

EphB3, NT (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (AP)

Sign In for Pricing
View Details
EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2, EPS8-like 2, EPS8-Related Protein 2, EPS8R2) discontinued
215625 50 µg

EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2, EPS8-like 2, EPS8-Related Protein 2, EPS8R2) discontinued

Sign In for Pricing
View Details
Protein disulfide-isomerase A4 (PDIA4) Bovine ELISA Kit
G2687 96 Tests

Protein disulfide-isomerase A4 (PDIA4) Bovine ELISA Kit

Sign In for Pricing
View Details
Butyrylcholinesterase (BCHE) (NM_000055) Human 3' UTR Clone
SC206636 10 µg

Butyrylcholinesterase (BCHE) (NM_000055) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum CDK5RAP1-like protein (cdk5rap1), partial
MBS1325683 Inquire

Recombinant Dictyostelium discoideum CDK5RAP1-like protein (cdk5rap1), partial

Sign In for Pricing
View Details