Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N4BP2L1 Rabbit Polyclonal Antibody (HRP)

N4BP2L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CG018

UniProt

Q5TBK1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human N4BP2L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_438169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin A / PPP3CA (BF1.1), 1mg/mL
BNUM2283-50 1x 50 µL

Calcineurin A / PPP3CA (BF1.1), 1mg/mL

Sign In for Pricing
View Details
Human EXOC3L4 activation kit by CRISPRa
GA114158 1 Kit

Human EXOC3L4 activation kit by CRISPRa

Sign In for Pricing
View Details
MASPIN (SERPINB5) Human Gene Knockout Kit (CRISPR)
KN424287 1 Kit

MASPIN (SERPINB5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin
ICH1037-25mg 25 mg

Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Uncoated Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-UNEL-M0077-01 5x 96 Tests

Uncoated Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-UNEL-M0077-02 15x 96 Tests

Uncoated Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details