Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF24 Rabbit Polyclonal Antibody (Biotin)

NBPF24 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NDD8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NBPF24

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDSTLIG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IgG (H+L), Human Serum Adsorbed - 20nm Gold Conjugate
AC-20-15-05 0.5 mL

Anti-Mouse IgG (H+L), Human Serum Adsorbed - 20nm Gold Conjugate

Sign In for Pricing
View Details
ANP32E Protein Vector (Human) (pPM-N-D-C-His)
PV322365 500 ng

ANP32E Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Lentiviral human PLD3 shRNA (UAS) - Lentiviral human PLD3 shRNA (UAS) (100)
GTR15116994 1 Vial

Lentiviral human PLD3 shRNA (UAS) - Lentiviral human PLD3 shRNA (UAS) (100)

Sign In for Pricing
View Details
NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1) (MaxLight 750)
MBS6239677-01 0.1 mL

NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1) (MaxLight 750)

Sign In for Pricing
View Details
NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1) (MaxLight 750)
MBS6239677-02 5x 0.1 mL

NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1) (MaxLight 750)

Sign In for Pricing
View Details
Canine Prostaglandin E2 (PGE2) ELISA Kit
MBS2603450-01 48 Well

Canine Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details