Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF24 Rabbit Polyclonal Antibody (FITC)

NBPF24 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A6NDD8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NBPF24

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDSTLIG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Hyaluronate binding protein ELISA kit
GTR10429011 96 Well

Goat Hyaluronate binding protein ELISA kit

Sign In for Pricing
View Details
Sample Concentrator BCON-107
BCON-107 1 Unit

Sample Concentrator BCON-107

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)
MBS2132907-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)
MBS2132907-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)
MBS2132907-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)
MBS2132907-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Tetraspanin 25 (TSPAN25)

Sign In for Pricing
View Details